PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26289.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 271aa    MW: 30074.8 Da    PI: 8.3271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26289.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.58.6e-201560147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEd+ll ++v+++G ++W++I++ ++ gR++k+c++rw + 
  mrna26289.1-v1.0-hybrid 15 KGPWSPEEDDLLRKLVQRHGARNWTLISKSIP-GRSGKSCRLRWCNQ 60
                             79******************************.***********985 PP

2Myb_DNA-binding582.2e-1869111347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++T+eEde+++ a+ ++G++ W+tIar ++ gRt++ +k++w++ 
  mrna26289.1-v1.0-hybrid  69 AFTAEEDEIIAAAHSKYGNK-WATIARLLN-GRTDNAIKNHWNST 111
                              79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.371065IPR017930Myb domain
SuperFamilySSF466891.26E-3112108IPR009057Homeodomain-like
SMARTSM007173.9E-171463IPR001005SANT/Myb domain
PfamPF002499.0E-201560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-261667IPR009057Homeodomain-like
CDDcd001676.13E-161759No hitNo description
SMARTSM007173.6E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.90467116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-2368115IPR009057Homeodomain-like
CDDcd001678.88E-1269112No hitNo description
PfamPF002493.5E-1569111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDCESVQQRE LDRVKGPWSP EEDDLLRKLV QRHGARNWTL ISKSIPGRSG KSCRLRWCNQ  60
LSPEVEHRAF TAEEDEIIAA AHSKYGNKWA TIARLLNGRT DNAIKNHWNS TLKRKYSSMA  120
EDGGGGGVEE NQYHILRPEK KSATASVSGR GYSPTSPSGS DVSDSGVAPA VTSAQVFWPM  180
ARAVMRTESP PPRNEPEPST LLTLSLPGGS EVATRREEKT TSLCLTTSLD ENQNRTMSFG  240
PEFMSLMQEM VRKEVRNYMD DKHLGIPKLS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-39121184110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305954.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW15e-84MYB44_ARATH; Transcription factor MYB44
TrEMBLD9ZJ571e-118D9ZJ57_MALDO; MYB domain class transcription factor
STRINGVIT_07s0129g01050.t011e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-72myb domain protein r1